Description 0 Reviews Description SLC7A10 Antibody | 292-ASC-112AP Expression system: Yeast Purity: > 90% SDS-PAGE Suitable for: SDS-PAGE Product name Recombinant Mouse SLC7A10 protein (Tagged) Purity > 90 % SDS-PAGE. Expression system Yeast Accession P63115 Protein length Protein fragment Animal free No Nature Recombinant Species Mouse Sequence WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ Amino acids 475 to 530 Additional sequence information N-terminal 6xHis-sumostar-tagged View AllClose 0 Reviews View AllClose
Add to Cart Quick view TK Antibody | Gentaur GENTAUR MSRP: Now: $340 Was: TK Antibody | 399-CSB-PA234835