Single Domain Antibodies: Therapeutic Tools for the Future? In this blog, ProSci will take you through the advantages of single-domain antibodies (sdAbs)—als … read more 28th Mar 2022 ProSci
Ordering and returns Shipping Terms:All orders are shipped via air, EX Works Factory. Freight charges, once determined, … read more 12th Feb 2022
Gen9 Suppliers Through our European office we import these reagents for RUO For an offer contact us at info@ … read more 12th Feb 2022 Lieven Gevaert, Gen9bio Inc.
Description 0 Reviews Description SLC7A10 Antibody | 292-ASC-112AP Expression system: Yeast Purity: > 90% SDS-PAGE Suitable for: SDS-PAGE Product name Recombinant Mouse SLC7A10 protein (Tagged) Purity > 90 % SDS-PAGE. Expression system Yeast Accession P63115 Protein length Protein fragment Animal free No Nature Recombinant Species Mouse Sequence WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITD KPLKTQ Amino acids 475 to 530 Additional sequence information N-terminal 6xHis-sumostar-tagged View AllClose 0 Reviews View AllClose
Add to Cart Quick view TK Antibody | Gentaur GENTAUR MSRP: Now: $340 Was: TK Antibody | 399-CSB-PA234835
