C1orf151 Antibody, middle region | 247-ARP44801_P050

Product Info Tested Species Reactivity Human

Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit

Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clonality Polyclonal

Host Rabbit

Application WB

Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C1orf151

Purification Affinity Purified

Predicted Homology Based on

Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Complete computational species homology data Anti-C1orf151 (ARP44801_P050)

Peptide Sequence Synthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ

Concentration 0.5 mg/ml